Search
Menu
Lumencor Inc. - Advancing Insights LB 5/24
Photonics Marketplace

Show Filters
Hide Filters
Suppliers by Category

Regions

US States

Countries

LPC/Photonics.com - Marketplace Banner Animated 6/24
DataRay Inc. - New Laser Beam Profilers
0 suppliers

Rear-Projection Screens

Clear All Filters xmonocrystalline substrate xIllumination & Displays xScreens xRear-Projection Screens xAustralia xNew Zealand x

Sorry... your search has produced no results.
Please refine your selections or clear all filters to try again.

Clear All Filters

Glossary
  • television projection A television display system in which the television signal is converted to an image that is projected onto either a front or rear projection screen.
  • screen The large, usually flat surface onto which an image is projected for viewing. May be reflecting or transmitting (rear projection).
Rear-Projection Screens Suppliersrear projection screensrear-projection screensrear projecting screensimagingdisplaysviewingproject from rearreflectingtransmittingrear projection

We use cookies to improve user experience and analyze our website traffic as stated in our Privacy Policy. By using this website, you agree to the use of cookies unless you have disabled them.